DPCstruct | MC45389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 306 ± 88 aa |
| Standard deviation of domain lengths | 88.31 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812T848 | 24-316 | HSQQLSWAKGTLQDISREHHPTDYLAARLDRETKIAKQLGTLGGGNHFIEVVYSEGSEQVWCMLHSGSRNVGNTTASFYDQVAGNRG… |
| A0A101F9V5 | 15-340 | KEGDMKVDAIIFTDAESVNDPQFREAMKQLMNVATLPGIVKYALAMPDIHWGYGFPIGGVAAFDVKEGIISPGGVGFDINCGVRLMK… |
| K2SS15 | 784-1155 | None |
| A0A1R3KY54 | 22-385 | None |
| A0A146HZ08 | 126-458 | None |
| A0A0S4JN45 | 55-393 | None |
| A0A7I8CT62 | 15-207 | None |
| A0A379FF35 | 34-324 | None |
| A0A0K0EKR2 | 958-1382 | None |
| A0A2V3YL73 | 28-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.