DPCstruct | MC45384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 247 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061BTJ2 | 731-985 | FSGSTKTGRQLCEIIREFLGSGVVSSLFGLSPTPPKTLPEHFSFGLSLVNKWVKVASYITDAGIKPVSQTKIEASIQTLSIKLCTDT… |
| S6B7V1 | 1-246 | MPGPRGPLEYYCDPVKCHGTLVVLLRLLACITPTVPRTLGDLFGFYYYIVYIGGNSSGGGGKKEVYQKLEKELRDVRLSMLGSGNDA… |
| A0A061BIT0 | 238-459 | None |
| A0A1X1BPQ0 | 441-688 | None |
| A0A1X1BMM3 | 1-262 | None |
| A0A1X1BIJ6 | 768-1006 | None |
| A0A061DCQ0 | 96-330 | None |
| A0A061BL59 | 58-323 | None |
| A0A2H6KJY9 | 644-892 | None |
| A0A1X1BJQ2 | 592-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.