DPCstruct | MC45382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 262 ± 61 aa |
| Standard deviation of domain lengths | 60.60 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061BJJ5 | 59-298 | MGFLSGVLSNIKEHLGQHKDIIQPVIDTLNTNKHGGKKGFNEAIGSVVEGVRGYNKAVEQSNTSIKTPIRNLYSYLKPEKGELTIGL… |
| A0A061BIV5 | 1-245 | MGFLSGVLGAVKDDPSVTTYYTGMETTLQKIKDNMHNPGGLSAAVDAVSTALGEWDGELNKRCTDVKNYFNNLNSDKLTQFNNSLNA… |
| A0A061BK56 | 2-329 | None |
| A0A061BJH7 | 1-196 | None |
| A0A061BJN6 | 196-483 | None |
| A0A061BKF8 | 263-568 | None |
| A0A061BQI6 | 1-290 | None |
| A0A061BKH6 | 60-413 | None |
| A0A061BKR8 | 1-332 | None |
| A0A061BM99 | 94-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.