DPCstruct | MC4538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2C1E7 | 1-106 | CRRMYRARRTLLVKFENDAIDESDELERVLQEAKGIMRLKRPMIDFDIRLKTITGTHITPLTQDIFVDTPLDSLDPLLPLRSAAREN… |
| M1BVB0 | 23-160 | DYDPETVVSLTKFADQLPSVFGELAQGISEFKPTPSENLECFKNAYNVKRTLLVKFDNDAIDETDRLEETLKPRVESYGGKVEKIAL… |
| A0A7S2D1P0 | 13-147 | None |
| A0A392M7N0 | 8-174 | None |
| R1C1V0 | 302-440 | None |
| A0A0Q3VNC4 | 4-115 | None |
| A0A0A9BR99 | 2-148 | None |
| A0A022QKW9 | 37-215 | None |
| A0A7S0ZJJ8 | 3-122 | None |
| A0A392MWS8 | 35-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.