DPCstruct | MC4537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 232 |
|---|---|
| Mean domain length (aa) | 101 ± 20 aa |
| Standard deviation of domain lengths | 19.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.69 |
| Pfam Score | 97.38 |
| Assigned Pfam label(s) | CL0123- PF14379 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1BTV0 | 6-115 | DGVGGGESYLYENDGVMMTRDPKPRLRWTAELHQQFVDAVTKLGGPDKATPKLVLRLMGMKGLTLYHLKSHLQKYRLGQLAKKQNAA… |
| A0A087H293 | 1-81 | MMSIRWNDDLHRLFVHVVEQLGGEQKATPKPIFELMNRGELTLEQIKSHLQWYRITKQKEAITNKRQENIIKQQMIQWETH |
| A0A6A6LCV1 | 57-189 | None |
| A0A068UZ73 | 6-119 | None |
| A0A2J8AGI5 | 304-427 | None |
| F6H579 | 1-70 | None |
| K3ZWF0 | 83-199 | None |
| A0A6S7NKD2 | 936-1020 | None |
| A0A061R2D3 | 210-323 | None |
| A0A6J1AFU0 | 779-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.