DPCstruct | MC45369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 272 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.75 |
| Pfam Score | 98.50 |
| Assigned Pfam label(s) | PF07896- PF03016- PF01288- CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3GT60 | 20-160 | ISNHFSRKRNILFKTGVPMFTLALRKKFIAHHHAASEIDADHPMRSHLYILEVMLEAEELDSEGYVLDLDELEAEVDDILSQYAYKS… |
| A0A1X1EX88 | 1-118 | MSTTLFKEFQFEAAHRLPHVPEGHKCGRLHGHSFLVRLEITGEVDAYTGWVMDFAELKAAFAPIYDRLDHHYLNDIPGLSNPTSEVL… |
| A0A6S8B586 | 8-195 | None |
| A0A7C5VEH8 | 78-230 | None |
| A0A7W5S3D5 | 2-97 | None |
| B9EM09 | 60-204 | None |
| M1V5S6 | 46-204 | None |
| A0A497I5S0 | 2-106 | None |
| A0A7U6QJ76 | 2-117 | None |
| R5G886 | 354-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.