DPCstruct | MC45365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 105 ± 23 aa |
| Standard deviation of domain lengths | 22.64 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6AKF8 | 2-65 | AMPDPIEAIKFRMEQLGMKQKDLVAVVGYKSRVSEILSKKRKLTLDIIRKLNTTLHIPTEVLVQ |
| A0A2T4ZXU6 | 2-95 | VRAIQDTLKHPAMSLADIVGDLIEDYEALHLRLPDTTDIDTLKFLMQQHGLKQNDLTEIGSQGVVSEILSGKQELNIRQIRALSKQF… |
| A0A2S0VQQ3 | 16-135 | None |
| A0A7U0I983 | 11-83 | None |
| A0A2E2B7G9 | 25-147 | None |
| A0A7Y5RRX7 | 53-174 | None |
| A0A2M7PDM7 | 21-150 | None |
| A0A1C4DB95 | 9-125 | None |
| A0A0B3AXE2 | 1-75 | None |
| A0A661F2E9 | 9-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.