DPCstruct | MC45362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 291 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8UY49 | 183-471 | PLNSTDNLHGPTEDDIRVATKDIPTSDAAPPRVDINELVLQSDLQFDVRKVLISLAMSSAYVIGAGPFATRLISMLRQRLLNKRKHQ… |
| A0A820ZN25 | 1-245 | FRTDLGRVLFTLIEISYKLLWYHSDAEHIFKEAEEILSKSSRTESNHQEMHKNQIEKLVHMGFTAQHAQDALERTKYDLNAAMKLLS… |
| A0A0N7ZB13 | 140-461 | None |
| G1L9Z7 | 1-305 | None |
| A0A3B0JQ67 | 142-424 | None |
| S9YRQ2 | 515-827 | None |
| A0A384D6W7 | 273-538 | None |
| A0A819NIX5 | 380-667 | None |
| A0A814XIQ3 | 120-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.