DPCstruct | MC45361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 231 ± 33 aa |
| Standard deviation of domain lengths | 33.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820X461 | 18-232 | MLEDSVEAIHALENVHVRFVPATTNNNLLQPQFFGTRFYCKVVIPLPAHMFARLPQKLKDGASILIVPVVFNIGIDHRASLARMKAF… |
| A0A6C8H423 | 263-498 | GEAVSLKLVSVGLLTASNIFGKEGTMVEDQMRAWQSLTQPGKMIHLKIRNKDGDLQTVKIKPDVAAFNVGVNELALKLGFGLKASDS… |
| A0A1M3CQE8 | 335-622 | None |
| A0A2H2JLC4 | 34-235 | None |
| A0A2A2KLV6 | 559-776 | None |
| A0A4W6EWU1 | 498-714 | None |
| A0A3B4AQ21 | 582-771 | None |
| A0A2H9TA20 | 562-818 | None |
| A0A7S3GLT4 | 1-168 | None |
| A0A1E4ZJX5 | 627-854 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.