DPCstruct | MC45360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 55.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819SZM5 | 1-59 | VKKAWLGVDYKQAGIAGNDMHRSNVPNTRIGYRYDVLCEELHLLKVAYHSRQEVILFHL |
| A0A6L5CFG0 | 118-162 | MKQYWLGPNYTKEGVAGNDISRTNVPNIRVAYRHETLLDELSNIF |
| B0CWW5 | 40-82 | None |
| A0A0K2USK1 | 1-49 | None |
| K1PVW9 | 144-197 | None |
| A0A6J3CB39 | 35-79 | None |
| A0A819D6G0 | 19-76 | None |
| A0A0A9XGN5 | 81-128 | None |
| A0A0C2CK33 | 94-145 | None |
| A0A815X0H5 | 36-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.