DPCstruct | MC4536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 232 ± 64 aa |
| Standard deviation of domain lengths | 64.34 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 71.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 62.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y5W5 | 63-212 | LAHLFLEIIPTQLEVMHICHTNLKASTSAEVGRFIKQLLETSPDILREYLIHLQEHMINVITASTPAARNIHIMIEFLLIILTDVPK… |
| M1BRK1 | 2-209 | HIFYTNFKASTSAEVECFIKQLRQTSTDILREYLVHIQEHMVTIVAPTTSGARNIHVMIEFLLIILFDVPKDFNHHDKLFDLLERVG… |
| A0A2G2V9P6 | 295-450 | None |
| A0A1J6JYJ4 | 142-455 | None |
| A0A2G3AWE8 | 1-213 | None |
| A0A2G2WTQ9 | 85-296 | None |
| A0A2G2WTN2 | 1-151 | None |
| A0A1U7WQ30 | 230-396 | None |
| A0A2G2V7Q9 | 2-195 | None |
| A0A2G2XVS2 | 45-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.