DPCstruct | MC45354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395GXT2 | 1-194 | MAHQAHNICWNILANNLIHRSPAYPDADLASNLYFRFKPAQGKEVGYFAESFARNIAEHTKCERQKYPAKFDPIQPDEVLLDDRTAE… |
| B8MGD7 | 43-245 | HQTHNIPWNTLASHLKIYWPDIPTWQNPSNLYFRSKDNQENDVRYFATCFAKTIREHTTCERKKFAENYDVSGKDDIILDDTTVQKT… |
| A0A842ZBV5 | 1-158 | None |
| A0A4Q7JLF5 | 1-227 | None |
| A0A1L9UYC1 | 57-213 | None |
| A0A1R3RXA1 | 1-187 | None |
| A0A1B8AB96 | 1-222 | None |
| A0A0J0CI31 | 2-180 | None |
| A0A1L9N9I0 | 1-170 | None |
| A0A4E9E0M0 | 448-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.