DPCstruct | MC45350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 108 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2XZT9 | 156-260 | KLEKFIFDVLAVSRKPVILEVSRGDEFAPVKNATGQDSAEAAAAYLSAQAVRWASQAGARINGQRNNSICPDMPRLSEISPLLSYEG… |
| M2R8X9 | 2-96 | FFFDVFPLATKVSIFEIQRFIEFSALKNSLNESFDNVNTVKRDWYRLNIYYLKKAGAIVDDSKSPICEISFRKSFEEEGLKEFKGKT… |
| A0A452VF23 | 99-258 | None |
| A0A226ELQ1 | 562-713 | None |
| A0A2H6KDZ5 | 800-938 | None |
| A0A1V2LGY3 | 859-958 | None |
| A0A7R9LH70 | 252-414 | None |
| G3JJN2 | 790-884 | None |
| A0A7S1T2B7 | 311-426 | None |
| A0A167PE30 | 122-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.