DPCstruct | MC4535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1BRC7 | 1-92 | MQSANGLGLQAASGRDYCEVIMKFPGETVPKWKDPKTGELEGLSYELNLCEAVATWEQVRNSTTVLTKEYIDALPNGWEDYAWRRIN… |
| A0A371DZ19 | 59-143 | NGLGLEATRGTDYCQTTINFPSDTIPKWRDPKTGELEALSFDFNLCEAVATWEQVRNSTTILTKEFIDSLPNGWEEYAWRRINKG |
| A0A453MXK6 | 79-165 | None |
| A0A2N9IIE9 | 69-149 | None |
| A0A7J8LUX0 | 1-86 | None |
| A0A2G5CRF8 | 57-144 | None |
| A0A0D3EZW0 | 3-81 | None |
| A0A7J0H2K8 | 57-141 | None |
| M1BRC6 | 1-92 | None |
| A0A427AQ64 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.