DPCstruct | MC45345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 148 ± 11 aa |
| Standard deviation of domain lengths | 11.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MZE3 | 648-809 | FVINMCLPDLPQLEDYIHRVGRVGRADTMGLAISIVSKVPERVWYCTKKGYKPWFEPNKKNTKLVTEGGHTKWFDEPSIIKQVERRL… |
| A0A7S2USM6 | 3-128 | MGLAISLVAAPSVKEKVWYHTCKSRGRGGSCNRRHLTDDGGCTIWYDEPGLLKEVEKRLGGKPLPALQQDLSLPDGMGGGGVRYGEQ… |
| A0A7S2YVG3 | 66-227 | None |
| A0A132A8G4 | 571-713 | None |
| A0A7J6KXU1 | 2-154 | None |
| A0A3S3RUS2 | 438-587 | None |
| A0A2G9V5E1 | 374-514 | None |
| G3HFI6 | 430-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.