DPCstruct | MC45344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 462 ± 74 aa |
| Standard deviation of domain lengths | 73.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 82.50 |
| Assigned Pfam label(s) | PF14624- CL0363- PF01294- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2USJ4 | 1-445 | GMYSFIPDCAMVGTVFVNALSNLLSTFATNITLSIEPTNGAQIQGNTVLGGYPAQFASWGVSMDLGSLSFGQSKDIVLPWVMPERDS… |
| A0A816RB62 | 28-528 | ISALFLLTDGCPTEIPEGGRLEALEKLKKKINFTCTVNTFGFGYQLDSKLLEDISILGNSGSYAFIPDGGFVGTIFVNAISTLLTTT… |
| A0A814UG03 | 158-513 | None |
| A0A813R3G6 | 420-925 | None |
| G4UZI1 | 244-742 | None |
| A0A7S0CHI9 | 3-386 | None |
| A0A2E0S7V8 | 239-783 | None |
| R1DD40 | 490-924 | None |
| M1WEK6 | 213-745 | None |
| A0A0G4M3D2 | 264-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.