DPCstruct | MC45343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376TWA7 | 4-73 | RQIIGADGLIFQDLNDLIDAVRAENPDIQQFECSVFNGVYVTKDVDQGYLDFLDTLRNDDAKAVQRQNEV |
| A0A6U1PNR4 | 2-86 | SELVAFDKSNEEVAKAIGADAVIYQDLEDMIKSVVELNPDIKQFDTSCFTGEYVTGGIDEAYFQALREARSDRALAKKNMTVASG |
| A0A4S4LVJ5 | 362-443 | None |
| J4V0T0 | 1-88 | None |
| A0A4Z0A819 | 134-241 | None |
| A0A7S2DZE8 | 26-160 | None |
| A7C047 | 26-112 | None |
| A0A5N7ZFL0 | 672-751 | None |
| A0A284QVZ6 | 647-763 | None |
| A0A447N6Z2 | 128-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.