DPCstruct | MC4534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0VMZ1 | 1-99 | MLRFVRSCLQFLLKLVNSVIGLMGMGMTLYSLWMLRVWYKQVHSFWTSGPDSTLPWFIYTCLGLGVYFCIISCAGHISAETANGCCL… |
| M1BK82 | 1-99 | MTRMARSCMQSLLKVVNSVIGMVGIAMILYALWMFRVWHKQMGPYPPPFFGPDAPAPWFIYATLGLGITLSIVTCSGHIAAETANGC… |
| A0A426ZXG6 | 1-108 | None |
| A0A453DGV8 | 1-111 | None |
| A0A2H5Q0V3 | 1-142 | None |
| A0A7J6HFH0 | 605-725 | None |
| A0A843UQQ6 | 145-238 | None |
| W9S1Z7 | 1-90 | None |
| A0A498HD34 | 629-745 | None |
| A0A7J7HTP2 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.