DPCstruct | MC45331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 227 ± 55 aa |
| Standard deviation of domain lengths | 55.05 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843DHA5 | 1-166 | FILPGHVCAVMGYHEYEQFKVPQVVAGFEPEDVLLGLLMLAEQIENGEAKVENAYPRVVSREGNVKAQRLMHEVFTPTDVEWRGFPV… |
| A0A833GXR1 | 44-299 | VRMVYSCIETIEIAGRHPDKQVVFFAIGFETTTPPTAVLMQRIAAGGIKNLSVVCNHVLTPAAIQHILNAPVLREMEAVRLDGFIGP… |
| A0A0J7KIL1 | 52-310 | None |
| A0A1F2VQY5 | 12-198 | None |
| A0A6A9T187 | 208-495 | None |
| A0A357NG42 | 132-414 | None |
| A0A3B0SPK5 | 25-154 | None |
| A0A7V2XAU9 | 69-191 | None |
| A0A7C3WEY0 | 20-231 | None |
| A0A480BRJ8 | 520-769 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.