DPCstruct | MC4533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 99 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.59 |
| Pfam Score | 92.08 |
| Assigned Pfam label(s) | CL0221- CL0416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BPZ5 | 105-200 | MPAAFVSFNSQWGAAVCAQTQQTSNPTVWLTEWAPEPRDVYWPNLAIPFVELSVRRLIMAVALFFLTFFFMVPIALVQSVANLDDIE… |
| M1BCX8 | 1-99 | MPASFVSFKSRWGAAVCAQTQQSRNPTLWLTEWAPEPRDVFWNNLAIPYVSLTIRKLIIAVSFFFLTFFFMIPIAFVQTLASLDGIR… |
| A0A834ZBB8 | 101-200 | None |
| A0A392M5H9 | 52-151 | None |
| J3NCW5 | 106-205 | None |
| A0A6A3CTZ0 | 202-304 | None |
| A0A2I0W0U6 | 397-499 | None |
| A0A835ILE0 | 1-83 | None |
| A0A453BPN7 | 1-98 | None |
| A0A7N0TF97 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.