DPCstruct | MC45329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 115 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177A8M3 | 2-115 | SPILANKLMKATVAKFLKLYQPPFFPFRSLSERVVELDLISATGVTGDQLLVSNSVYPPFTTDIIQAFTRINYLQNLGVIHGLETMV… |
| U9UMG1 | 29-140 | ILWKYGLAPKKVQNLVKEIVGKFLEEYKFDEPYTSIDSESERLQLNKELKFTAQYYFSELEKINQLYLQHFVEPMTRVNYGQNLAEL… |
| A0A6A6P782 | 70-196 | None |
| A0A812VMW8 | 10-127 | None |
| A0A0C9TTN1 | 72-170 | None |
| A0A815B1D3 | 140-259 | None |
| Q0U8E1 | 50-154 | None |
| A0A819P7C4 | 16-124 | None |
| A0A5N5CYF3 | 565-667 | None |
| A0A815Z084 | 372-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.