DPCstruct | MC45323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 205 ± 46 aa |
| Standard deviation of domain lengths | 46.34 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 99.38 |
| Assigned Pfam label(s) | CL0274- CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284QVZ6 | 7-214 | PRLHLRDTRDAHIIFEAVRQGFLKPVTRRLNEAERSMSVRSGAVFVWEERDDESGLKRWTDGRLWGQSRMREPYLFYDEKLPSAHGG… |
| A0A165GV23 | 3-119 | SILKPSYEGYVGTPDEARRVVQGCVMGILHHAPRRMRKSEEAELIQSGNVFVVEKNASGIEEWVDSVDWNASEPLKKKTFTVTMHGH… |
| A0A146HXZ8 | 257-491 | None |
| W2S633 | 2-183 | None |
| A0A0D2P2W1 | 57-326 | None |
| A0A5N6EAE2 | 29-222 | None |
| A0A7I9EKD1 | 1-247 | None |
| A0A0H2RVX0 | 1-212 | None |
| A0A2U3DNY9 | 1-158 | None |
| A0A2C5XGE2 | 154-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.