DPCstruct | MC4532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 64.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8LFT9 | 1-133 | MELGPVSTCLAAVSCSSEQAPLRPLGSPVGDGASTVLKSILDRASELIRANNFNNAGIALWRASFNEFFNMLMRYCISKYDSIMQSL… |
| M1BB05 | 1-138 | MDLNSLSACLAAIVCSSEQPPLCPLGSPAGDGAYVILKSVLERPSHLLTDPQAGGSFSMPNPALWQSSFDAVFGLLTKYCLSKYESI… |
| N1QY99 | 652-795 | None |
| A0A314YFG1 | 38-185 | None |
| A0A2R6QHW5 | 290-427 | None |
| A0A314UL44 | 144-297 | None |
| A0A438HEG6 | 144-276 | None |
| A0A5P1EGD7 | 304-460 | None |
| A0A7N2LJQ1 | 976-1113 | None |
| A0A6J1ANF6 | 239-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.