DPCstruct | MC45318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 440 |
|---|---|
| Mean domain length (aa) | 174 ± 33 aa |
| Standard deviation of domain lengths | 33.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.26 |
| Pfam Score | 99.40 |
| Assigned Pfam label(s) | PF11655- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9NTZ7 | 79-248 | ETPTQKIEALDNSLDYRSTYVMVKRHEGLELKAYDDSKGIRTVGIGFNLTRSGARARIESLGLDYSKVYNKKVEITVEQAERLFVDD… |
| A0A5V0AN32 | 3-143 | ISSNGITRLKREEGESLKAYPDSRGIPTIGVGHTGKVDGNPVVSGMTITSEKSSELLKEDLQWVEDAISSLVRVQLNQNQYDALCSL… |
| A0A2G2R589 | 214-436 | None |
| A0A849ED43 | 47-188 | None |
| A0A356F698 | 315-470 | None |
| A0A6A8A260 | 4-114 | None |
| A0A2I1DVJ3 | 1-103 | None |
| A0A4S2MPC4 | 76-235 | None |
| L8M7R8 | 330-499 | None |
| A0A2G4FLC1 | 113-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.