DPCstruct | MC45317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821X3Q8 | 1-63 | FPLVCPLTGKIIKGIARHLFIVSYRWLNECLSQETIVDERPYEIRGYTSLGSDHGGMRRSRLT |
| A0A815FYF1 | 513-575 | SVLVCPLTGKTIQGIARHLFIVSHRWLNECIAQDSIVDERPYEIRGDTSLGVDHGGMRRSRLT |
| A0A819WT12 | 16-93 | None |
| A0A814NER2 | 659-719 | None |
| A0A812BKM1 | 17-98 | None |
| A0A818BXZ6 | 221-294 | None |
| A0A670ZMY2 | 1160-1228 | None |
| A0A821IKR2 | 67-136 | None |
| A0A821HC04 | 121-184 | None |
| A0A819F7N7 | 612-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.