DPCstruct | MC45316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821WWQ0 | 11-111 | QIEKDNCFITKAAWISSEINIHCLTSIIILVSSGKLPWYALNVYLFSSQSCEAAFPSARSLSGSFSSITNFSVFEFMNKIEKISILN… |
| A0A815KAV5 | 90-179 | CFITRPACMSVELNAHNLPYLILLVQEKQLPKQALINIHLFSSQPCEAIFRDARSLSGTFSSTINFTVKDFIRRSKKLSILNQIKNN… |
| A0A815VBR1 | 219-339 | None |
| A0A816Q0F0 | 120-198 | None |
| A0A816UP70 | 2-117 | None |
| A0A821AE58 | 22-128 | None |
| A0A817QLM0 | 202-292 | None |
| A0A816E0L3 | 59-157 | None |
| A0A817MGH5 | 198-304 | None |
| A0A816EXV6 | 339-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.