DPCstruct | MC45314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 247 ± 58 aa |
| Standard deviation of domain lengths | 57.94 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146F5J4 | 300-568 | LSGIERATLSELIQIDKHYLTRITLRTKLIQDKRASVLGASPRSIPAVKELYSFLINDYLPQRYSAIFQRTSTTTSTSASAPTTTML… |
| A0A4Q4Y1U9 | 104-381 | LPRPYRPLRWAYHQTMALAKLEPDWWIELENTYQARIAQRQELYAKHGEAVLQWLPGSELACKELMEMVVQFICARYPQYFSLSPDR… |
| A0A816VJV1 | 419-683 | None |
| X6JWL6 | 14-289 | None |
| A0A3B9UD43 | 13-236 | None |
| K8EHR1 | 62-434 | None |
| A0A3D3NVG2 | 14-171 | None |
| C4JY19 | 93-273 | None |
| H0EVX4 | 38-228 | None |
| A0A834RMR1 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.