DPCstruct | MC4531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 18.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656H6T2 | 152-281 | LGPIGSNGLANARDFLTPVAWFEDSRQPMQLVQKFLGELWSTQLEHSPFDVVGWHGNNVPYKYDLRRFNTLGTVSYDHPDPSIFTVL… |
| M1B8J9 | 4-141 | NMYLGANGLAAPRDFLVPVAWYEDGSRPGYTIVQKYGGELFTAKQDFSPFNVVAWHGNYVPYKYDLSKFCPYNTVLMDHSDPSINTV… |
| A0A1B7YK57 | 288-447 | None |
| A0A1B8EWB3 | 93-197 | None |
| A0A6A5L4N8 | 451-606 | None |
| A0A835S3R6 | 226-383 | None |
| A0A6G0HLB0 | 72-210 | None |
| A0A367KQZ0 | 484-641 | None |
| A0A5N5SV45 | 209-376 | None |
| A0A4S8J089 | 210-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.