DPCstruct | MC45306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 432 ± 51 aa |
| Standard deviation of domain lengths | 50.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9U656 | 1-427 | MMNIQALKEDLGIEPDVAIERNKSLFERKLEIQTKQIVGEVQNIVYRESDRIINTISKSLQGPHDKLIDPDVHALWKEMGWGASVKA… |
| A0A2G8SI07 | 409-766 | EFRDESSEVMILRQELSHTPSSEIEKNLEMFERKFEIQTRELAEEMTSVVVHEGDRVISSVLAGPHDKIIDPDLFEVWKDMRWRGIV… |
| A0A4Q2DKH2 | 168-565 | None |
| A0A0C9X8F7 | 16-386 | None |
| A0A409WCP5 | 1-534 | None |
| A0A0C3C0P8 | 247-693 | None |
| A0A165T0I8 | 388-883 | None |
| A0A4Y7QDV0 | 309-687 | None |
| A0A165LJ34 | 298-759 | None |
| A0A4R0RPL3 | 306-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.