DPCstruct | MC45305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 26 aa |
| Standard deviation of domain lengths | 25.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0C624 | 1-110 | MGRSTPFPQTPLSRAQILERVNTIPQRPNMESGKRAYEADVNAWHQMHDNAPPGLERPYPVKLGMAQAGSGECFGCGAITDPPHMGY… |
| A0A5C3EC72 | 29-172 | QLPLTPPMDTGRFLPAPQQQYAQPFRPQQVQLPPSPPQNQQVVQPRLEEIAQMTFENTQQGHEQYRAAMEQFVCDHPCTTIQPPTDK… |
| A0A0C9U564 | 5-143 | None |
| J0CYL5 | 200-412 | None |
| A0A0D0D2R7 | 13-139 | None |
| A0A0C9V8L6 | 31-183 | None |
| A0A0C9V7M5 | 19-148 | None |
| A0A0C9V255 | 75-250 | None |
| A0A409XMM6 | 194-351 | None |
| A0A0C9UWM6 | 471-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.