DPCstruct | MC45301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 317 ± 52 aa |
| Standard deviation of domain lengths | 51.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TPD8 | 37-291 | WLGKPIEPKEGNERLEPIVTSFPVRIQQKDRKLDPALFFVGPRTIPLHHWLERDGNALFNRDELKALKWGWVISLLVVLVASGALVP… |
| A0A4Q4PZI7 | 408-770 | VARQLIDHYEGNLILSQLELVTLALECLHKRQTGEYLPGDHSYALMGLLRVRPQIDRTDSAFQAFARLSLANGSDQLLERLICMLPK… |
| A0A4U0XZN4 | 824-1204 | None |
| A0A1V6S125 | 43-359 | None |
| A0A284QTR2 | 382-670 | None |
| A0A4Q7JTJ5 | 295-652 | None |
| A0A0D0AH98 | 392-683 | None |
| A0A166SGA8 | 404-698 | None |
| A0A4S9C9H1 | 185-638 | None |
| A0A7J6JQF8 | 386-808 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.