DPCstruct | MC4530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.79 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0306- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388NS44 | 1-110 | MNFTELESKTLDELRGIAKDSEIIGYNHMKKQDLVLRLMRAHAEKRGLGLRGGVLEIVDDSMGFLRGGNLMPSHDDIYVSQSQLRRF… |
| A0A845EV40 | 7-113 | SHLETLTLKEIYTLAREYKVSYYAKLTKRELIFSILKAQAEKDGFLFMDGILEIIPSEGFGFLRPINYSPSAEDIYISASQIRRFDL… |
| A0A402W8A8 | 1-114 | None |
| A0Z3B3 | 129-247 | None |
| A0A2E7CJP9 | 3-127 | None |
| X1AN15 | 1-116 | None |
| A0A073J1A0 | 210-326 | None |
| A0A1U8N4M4 | 326-444 | None |
| A0A1H6KMR0 | 190-306 | None |
| A0A3R7UMF9 | 131-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.