DPCstruct | MC453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U3UY97 | 5-81 | LTDDRRQEVCDWLTANGINPNDVPVDADVEIQGDGDQRTLRCEVYVTNEFGDKVRDETGNDIARNHIGVPLAVEPPE |
| A0A6B2Z698 | 5-96 | SLTTTVPAPPDDDPFWDSPFHDQVKDWLQANNIELRIPRRDITITGPPGNRTVRYTAFVFNADGHVRVDPDNEGEPLAEERTAPCLV… |
| A0A7W5FHZ7 | 168-241 | None |
| A0A5S5CLH9 | 2-81 | None |
| A0A136PY03 | 6-75 | None |
| A0A429Q7V4 | 11-126 | None |
| A0A7L6B7Z9 | 1-79 | None |
| A0A7H8LR40 | 7-97 | None |
| A0A652LIK1 | 10-100 | None |
| A0A6G2VK59 | 10-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.