DPCstruct | MC45299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0209- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TA55 | 1-116 | PLVYSPPALTPESILRNIVESAPSLNYTCWQQIEPARKLINLAHVPVLMITSESGEHSNYDGCTARYLTQAGVPIQHLRLEDVGIHG… |
| A0A2K0W8Z0 | 126-230 | PVTYDPPVSDPSELESESVDEETLAHRNCYLQVEPARKLPQINKVPYLLLTGEASVHITYDHCVIDFLKQAGGKPEWIKLADWGIKG… |
| A0A179F559 | 935-1049 | None |
| M7U8A6 | 183-300 | None |
| A0A536STV3 | 1-106 | None |
| A0A0G4KMJ7 | 102-217 | None |
| A0A0G4N0D1 | 277-389 | None |
| G2XA51 | 195-288 | None |
| A0A2A3IVI5 | 420-533 | None |
| A0A2V8LXW9 | 64-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.