DPCstruct | MC45295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1VQ98 | 44-105 | EEKILTFACNWCSYAGADAAGVSRLQYPPHVRLLRTMCSGRVAESFIWHAFRHGAPVVLVSG |
| A0A2I0CVI5 | 4-83 | PPENPIVRQPGEWQPKILGIICNWCSYAGADLAGGGRIQNPTDIRIISVMCTRRIDLLFLMKQSSDGPGGVLGAACYLKR |
| A0A5K8AJX8 | 1-77 | None |
| A0A1M6DTN6 | 18-91 | None |
| A0A1F2WHV6 | 335-406 | None |
| A0A7J3ZRH0 | 201-262 | None |
| A0A318D1H1 | 1-75 | None |
| A0A7C7RSE5 | 231-290 | None |
| A0A7C1EAP6 | 5-70 | None |
| A0A0F9K2B3 | 454-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.