DPCstruct | MC45294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A410Q6U7 | 5-155 | TSNNMLILGVEGALRHVMEEYKLFFRSSERFKRFESYILGPSYTEAKIDVGILSALCKLPAPNFDQVVRTLLIEMVNGGSTTYDDIS… |
| A0A380YPI8 | 1-170 | MPIVFSIIFNELGLQQQSLREHLAKREEFLKAKARLSTLKRYIQSDADEQDLDMAMIAAVVKADSAELMHIVLALADEMVQQNLDLE… |
| R7IMF4 | 5-136 | None |
| A0A3A9BQJ3 | 77-239 | None |
| A0A7H4PQD9 | 38-184 | None |
| A0A379V238 | 98-254 | None |
| A0A2G2ML35 | 111-250 | None |
| A0A7H4M154 | 31-189 | None |
| A0A562GT16 | 102-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.