DPCstruct | MC45285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 44.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4VIZ2 | 1-75 | MKFGHLHYRRGVITYSLSPYEQKAFAGFFKDGFPNLMRRFREKVLIVGTPFVITYMIIEWANEENKRSKRKAAHM |
| A0A7R9FKN3 | 206-285 | MGKHFGELAYLRGIVQYRLSPFEQRAFAGAFTKGLWNIPVRIRASIFRVAPPFILGYLVYSSVERKHEQLMRKNPDDFKD |
| B3SBC7 | 80-159 | None |
| A0A6I9WHY1 | 22-114 | None |
| A0A7M4EPG1 | 227-315 | None |
| A0A6P4YLI1 | 1-75 | None |
| A0A643BTV9 | 89-173 | None |
| A0A194PEY7 | 1-82 | None |
| A0A6J1NX68 | 1-90 | None |
| A0A3P9C0J4 | 10-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.