DPCstruct | MC45283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 577 ± 107 aa |
| Standard deviation of domain lengths | 107.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.88 |
| Pfam Score | 80.39 |
| Assigned Pfam label(s) | CL0014- CL0040- CL0229- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5CG67 | 6-492 | TVYSVNAEQLKGSAWQVSTALVVICGSVPDSLVSALTSYLLRGGKLLCLCSDLLHMVLPEFRTAEVRTNELVTFSYQRWKKIKMLHH… |
| G4M078 | 11-635 | SNFSKQLNAVFKKSLSMTNRMSLINIYYVLSPGGVLSTPISPVYQKLVKKIQDVVVPNTALLYPLSRKQFSDELWITSGKLLVVLES… |
| A0A421JBQ6 | 1-666 | None |
| A0A6Q8PFK4 | 99-604 | None |
| A0A183MTC2 | 1-437 | None |
| A0A512UJ21 | 13-500 | None |
| A0A5K3F2J3 | 44-422 | None |
| E2AQ38 | 209-769 | None |
| A0A7I8V474 | 157-703 | None |
| A0A2B4RMQ7 | 279-863 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.