DPCstruct | MC45280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 169 ± 31 aa |
| Standard deviation of domain lengths | 30.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 97.32 |
| Assigned Pfam label(s) | CL0229- CL0103- PF02466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FA16 | 145-306 | DMDEFSRDPCPFRIVSDCGAAFAMGTIGGSVLHFYRGYRNAPSGYTKKLVSAMVNSRQRAPITGGGFAIWGGVFTAVDCSLVLARRK… |
| A0A814JLN6 | 5-144 | PCPWRIVDDCGGAFALGTIGGSLFHSIKGFRHAPSGQYRRLLGSLNAVKQRAPRVGASFSAWGAIFSTVDCSFVYLRKKEDPWNSIM… |
| F4PWV3 | 1-173 | None |
| A0A444WWV7 | 33-149 | None |
| A0A5N6Q4Y1 | 268-427 | None |
| G0P2Y5 | 396-553 | None |
| J4UHP8 | 51-234 | None |
| C4JSP3 | 160-307 | None |
| A0A5N6P4N9 | 893-1128 | None |
| A0A1E5UY50 | 115-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.