DPCstruct | MC45275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P1ULP3 | 69-154 | LGWGECATMILAEELEADQLLIDDLEARRVALSRNFKITGTLGILLVAKQLGLITSVQEVLDALITQGKHINPRLYQEVLSTAQES |
| A0A7J9TRA9 | 1-112 | YFSTKYDISIPDGSVITLSKYTSINLVQSDDQDVRDVLKSMGMQPVGSIGILLRAYREWIISYDDTTKALRDLLDISSLYVTSRLIQ… |
| A0A7W0TZ59 | 6-91 | None |
| A0A7J4LQQ0 | 1-86 | None |
| A0A0A7GC07 | 42-130 | None |
| A0A6S6RSI2 | 37-118 | None |
| A0A2M7CFB8 | 87-172 | None |
| A0A519BAU4 | 7-90 | None |
| A0A7X7FMA5 | 66-145 | None |
| A0A6I1KCH0 | 30-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.