DPCstruct | MC45270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9T0T1 | 1-94 | MIKRAKLLFKTGQLNVWIISKEDIFLLKSVTQRDDDEHDLLVLARSGLNWEAILTECIAQSRYDMMCEIDLYDKLDKLRTSYGLETP… |
| A0A7K3ZYI7 | 15-133 | FELSEPMWQRSILSRTFGDLVVKDASREDILIMKLIANRDGDADDCAALMGAGLDFDAVYEEIERQYRKAGELEQKIWITYIEEGIG… |
| A0A6G3ZQ79 | 2-99 | None |
| A0A218ZWD8 | 1-117 | None |
| A0A2G9PLS6 | 46-147 | None |
| A0A7J2YDC9 | 77-173 | None |
| A0A7J4JT38 | 43-140 | None |
| A0A7C5K024 | 128-254 | None |
| A0A849Q615 | 26-133 | None |
| A0A7J2YA92 | 401-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.