DPCstruct | MC4527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 241 ± 17 aa |
| Standard deviation of domain lengths | 17.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10720 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845EM32 | 1-211 | KDNISRTKAYFNYYVAHPEIKWSFLASMVSRNAGYNMTDLWLSPFTNMLNKRERSRMFMTYERANWLIFSDAYPQLLTYELSIYQNK… |
| S4Y6D5 | 18-249 | LTALLDELDARNVDNVARTESYLELYALTRAHPPDLPWLLMAHLVSRNAGALMTEIAAALDRREGAIAPSALRESFLFLERANHLIF… |
| W4QTU3 | 72-303 | None |
| A0A268E4W6 | 2-232 | None |
| A0A0C2R9V2 | 33-295 | None |
| A0A516KHP8 | 56-318 | None |
| A0A653UXK5 | 20-274 | None |
| D8H7G2 | 47-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.