DPCstruct | MC45258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9HAT1 | 10-117 | PVLVAPASFKGIFRATQVAGAIGRGLERAGLLPPDLCPVADGGEGTTDVLLPVLGGEIVAAPSHDRLGREVIRSFALLEDGTTALVE… |
| A0A640L256 | 1-66 | MKVVIASDSYKESLKAIEVCEAIERGFEAIFPKAEYVKIPIGDGGEGTVDSLVDAARGENYITSCN |
| A0A379FK66 | 2-105 | None |
| A0A7X9YIA2 | 181-297 | None |
| A0A7V3ADP1 | 290-416 | None |
| A0A2P1G4L8 | 8-143 | None |
| A0A850JPC4 | 13-89 | None |
| A0A447RSC0 | 2-122 | None |
| A0A447N6H1 | 317-431 | None |
| A0A852SJM8 | 73-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.