DPCstruct | MC45257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9H7S2 | 2-131 | VALADPPQAPGDRVPDGRSVEPRPGKPRRRRATPVAIVLFLLAIPVISGSLLALRAVYFVGTDPADGRTITVFRGLPYELPGGIRLY… |
| A0A1V5IGR8 | 3-76 | LSTVFFIAVEEDGRLAIFSGLPAEVGPVPLHAVYRRSVVAYDSLSPAARTLVDQRRLRGRQDALGVSEQLGMWP |
| A0A6L5G0W8 | 56-183 | None |
| A0A847A5M1 | 144-275 | None |
| A0A6J7SFG3 | 109-257 | None |
| A0A6J6R143 | 1-114 | None |
| A0A4R4SD27 | 35-153 | None |
| A0A374VTJ0 | 1-135 | None |
| A0A6J6XVX2 | 122-248 | None |
| A0A7V9KZL0 | 189-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.