DPCstruct | MC45256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 283 ± 39 aa |
| Standard deviation of domain lengths | 39.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9CFA3 | 12-279 | APLHASSAGYVAELGRQLGFAVPWINTTQYSTPVYTVPADAPTVRVALDVNVPELQQALEAVPIPAGAAAARGTDQHLTVWQPATDT… |
| A0A2V8UPV1 | 16-289 | PASSLWNTDISAAPVDPNSANIINFIGSTVTLHPDFGAGTFHNQSLGIPYQVVAGTQAKVNVTLGAFFDESDPGPMPIPSNALIEGY… |
| A0A7V2UY11 | 23-346 | None |
| A0A7V2V117 | 359-648 | None |
| A0A4Z0N692 | 234-515 | None |
| A0A422QM64 | 8-306 | None |
| A0A522TE59 | 134-401 | None |
| A0A7U4RCY3 | 157-416 | None |
| A0A538QKL0 | 103-436 | None |
| A0A4Q5X1D5 | 77-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.