DPCstruct | MC45254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9YXS0 | 179-324 | GEVAGGLGRGFAAGMVGAAAMSVSTTIEMKASGRAPSDVPAKALARLLGARDLGDTAERRMTAVAHVLTSGAIGGARGLLSGFGLRV… |
| A0A557Z9R2 | 2-136 | LRSAVWQGLVAGAAGTAVMTVAEKIEQRFTGRPDSQVPGAVLARLTGGRLRTTLLMHFGQGALVGGVRALMANAGLRGPVASAMFTV… |
| A0A4Q4VDW8 | 28-168 | None |
| A0A6G1J4N7 | 26-137 | None |
| A0A838E5G6 | 250-399 | None |
| A0A2W4M7Q6 | 28-187 | None |
| C5AXU0 | 5-126 | None |
| A0A5B9WCU1 | 131-289 | None |
| A0A1Q5MA90 | 2-109 | None |
| A0A6A6I7F0 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.