DPCstruct | MC45252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A173U5Y5 | 54-120 | RFETEVLDKPNFQGNAAVNYTDRKTPWTRIIEHKWFEFGKDDAGNDISKTVISREYSSEWKVGDEPY |
| A0A1E3G2D3 | 1-69 | MINEKSQGTFHAIVSVEMDQEYYQPVAVVNYPNDYDWTRITEYKYFLGEKSPKTVVHFEYSMPKGEPYT |
| A0A1S9CJS5 | 1-65 | None |
| A0A3A9FV32 | 404-469 | None |
| A0A7G9QKU1 | 7-62 | None |
| A0A1B7UC25 | 1-55 | None |
| A0A3M1SB02 | 4-65 | None |
| A0A7W1CFA5 | 1-59 | None |
| V8CDU3 | 77-138 | None |
| A0A3D8HLE9 | 192-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.