DPCstruct | MC45250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9AR08 | 258-337 | LLTETGASTGAIQIAGTDSDHQLPFFVTTCDYTLIGEELYAASAYLSREPVQVGTLRGQDIGKGIVLGMILIGTLLATAG |
| A0A7C6D774 | 2-91 | YLAESAAALDCISIAGTARATQLHFFVAACDYTLIAEEIFVISAYLTQDPTQLGMVRGGDISKVIACLLIAVGAISATLGQDIIGSI… |
| A0A496Q5T9 | 1-109 | None |
| A0A7X8A5I0 | 101-175 | None |
| A0A847PVP0 | 1-79 | None |
| A0A7V3VV35 | 624-690 | None |
| A0A2G6P0R7 | 530-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.