DPCstruct | MC45244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 202 ± 50 aa |
| Standard deviation of domain lengths | 50.24 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.33 |
| Pfam Score | 98.64 |
| Assigned Pfam label(s) | PF01765- PF01101- CL0061- PF01255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426H4U2 | 11-213 | KLPKHIAIIMDGNGRWAKEKGKLRVFGHKNGVVAVRDTVEGAAELGIENLTLYAFSTENWNRPKLEVTALMELLVATINKETKTLMD… |
| A0A6J3JQU2 | 3-155 | LARQKFSRLMEEQEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSD… |
| A0A534K804 | 109-312 | None |
| A0A6G3VKJ1 | 5-123 | None |
| A0A7V9V9N3 | 4-109 | None |
| A0A1S8VIZ3 | 19-136 | None |
| A0A1S8W379 | 153-333 | None |
| A0A1Y2HK49 | 143-401 | None |
| A0A6B2CDV5 | 3-222 | None |
| M1V3U0 | 4-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.