DPCstruct | MC45241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3V7D7 | 26-106 | LIAAFDHRHIFLDPTPDATSSYFERQRLFHLPTSTWDDYDRTCISPGGGVWSRAAKSIPLSDPARRALDVEADELSPHELI |
| A0A5E8P5H2 | 1-79 | VAAFNHMHIFIDPNPDAASSFVERQRLFNLPRSSWADYDAKLISAGGGIFLRSAKSIAITPEMKARFDIQADRLAPTEL |
| A0A829Q4S5 | 461-552 | None |
| A0A800M7L9 | 1-81 | None |
| A0A5C7Y1M6 | 610-707 | None |
| A0A811UYQ9 | 167-256 | None |
| A0A800AS75 | 32-122 | None |
| A0A1I7Y4X7 | 53-144 | None |
| A0A4Q7DGB7 | 356-449 | None |
| A0A448X3W1 | 199-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.